Issues

• ERROR: Bad base (Q) at site 15 of sequence 1 Printing error context: 6 MYDSYVDDKVGHVTQIIGPVVDIAFSSNKMPNIYN Problem reading alignment file

  brettc/partitionfinder#138 · Filter by author xiongqian123456789 opened on Nov 25, 2020
  2

• Running ~20 loci dataset

  brettc/partitionfinder#136 · Filter by author aberaslop opened on Mar 24, 2020
  1

• Error about working directory via

  brettc/partitionfinder#135 · Filter by author zhounan1356 opened on Dec 18, 2019
  1

• Error 522 to download anaconda

  brettc/partitionfinder#134 · Filter by author glichtenstein opened on Sep 10, 2019
  1

• Link to the example dataset in the tutorial is broken

  brettc/partitionfinder#133 · Filter by author joelnitta opened on Aug 20, 2019

• PartitionFinderProtein error: Failed to run models ...; not sure why

  brettc/partitionfinder#132 · Filter by author dongzhang0725 opened on Feb 24, 2019

• user_tree_topology handling

  brettc/partitionfinder#131 · Filter by author carloliveros opened on Jan 10, 2019

• Manual in Chinese

  brettc/partitionfinder#128 · Filter by author roblanf opened on Apr 1, 2018

• HDF5 error

  brettc/partitionfinder#127 · Filter by author roblanf opened on Oct 2, 2017
  1

• buffer size issue

  brettc/partitionfinder#124 · Filter by author roblanf opened on Apr 19, 2017
  10

• check_state_probs needs some tests

  brettc/partitionfinder#72 · Filter by author brettc opened on Oct 1, 2015 · PF2.0 Beta

• Installations on windows network drives seem to fail

  brettc/partitionfinder#48 · Filter by author brettc opened on Jul 9, 2015

• Consider packaging / distribution for 2.0 (maybe using a Conda recipe)

  brettc/partitionfinder#38 · Filter by author brettc opened on Feb 5, 2015
  2

• Allow for relocation of output folder

  brettc/partitionfinder#34 · Filter by author brettc opened on Feb 2, 2015

• Check error handling in threading

  brettc/partitionfinder#33 · Filter by author brettc opened on Feb 1, 2015

• Order of clustering steps can differ on different machines, even in reruns

  brettc/partitionfinder#13 · Filter by author cmayer opened on Feb 20, 2014
  1

• Catch segmentation faults from RAxML / PhyML

  brettc/partitionfinder#11 · Filter by author roblanf opened on Feb 18, 2014

• very small datablocks with RAxML

  brettc/partitionfinder#6 · Filter by author roblanf opened on Jun 16, 2013